PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004769m
Common NameEUTSA_v10004769mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 270aa    MW: 30944.4 Da    PI: 10.1032
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004769mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.36.2e-313787151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fss+gkl+eys+
  Thhalv10004769m 37 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYST 87
                     79***********************************************96 PP

2K-box103.92.1e-341062024100
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      ++ +  + +++e++  e+akLk+++e L++++R+++GedL+sLslkeLq+Le+qL+ ++k+iRs+Kn+ ++e+i+ lqkk k+lq++n++L kk
  Thhalv10004769m 106 KQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKK 199
                      56666778899*********************************************************************************** PP

            K-box  98 lee 100
                      ++e
  Thhalv10004769m 200 IKE 202
                      987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.6882989IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-412988IPR002100Transcription factor, MADS-box
CDDcd002654.82E-4030107No hitNo description
SuperFamilySSF554552.75E-3330119IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-313151IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003185IPR002100Transcription factor, MADS-box
PfamPF003191.3E-253885IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-315166IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-316687IPR002100Transcription factor, MADS-box
PfamPF014869.8E-29114200IPR002487Transcription factor, K-box
PROSITE profilePS5129715.766116206IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MARKRPYGLS FLPLVLEVLR REREREREMG RGRVQLKRIE NKINRQVTFS KRRSGLLKKA  60
HEISVLCDAE VALIVFSSKG KLFEYSTDSC MERILERYDR YLYSDKQLVG RDISQSENWV  120
LEHAKLKARV EVLEKNKRNF MGEDLDSLSL KELQSLEHQL DAAIKSIRSR KNQAMFESIS  180
ALQKKDKALQ DHNNTLLKKI KEREKKSGQQ EGQLIQCSNN SSILQPQYCV TATRDGFEGR  240
VGGENGGASS LTEPNSLLPA WMLRPTTTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-2229101172Myocyte-specific enhancer factor 2B
1tqe_Q9e-2229101172Myocyte-specific enhancer factor 2B
1tqe_R9e-2229101172Myocyte-specific enhancer factor 2B
1tqe_S9e-2229101172Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869290.0AF386929.1 Arabidopsis thaliana floral homeotic protein AGL8 (MSL3.3) mRNA, complete cds.
GenBankATU334730.0U33473.1 Arabidopsis thaliana agamous-like 8 (AGL8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394555.10.0hypothetical protein EUTSA_v10004769mg
SwissprotQ388761e-172AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBLV4MK960.0V4MK96_EUTSA; Uncharacterized protein
STRINGAT5G60910.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79225110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-158AGAMOUS-like 8